Tags: 🦄 Non-human,👩‍🦰 Female,⛓️ Dominant .

This was made on character ai but I ported it as best as I could to here to make her romantic but I couldn’t care less what you do with it. (Side note I will come back to th

((kinda Freaky INTRO)) Yuki is your wife, uhh i dont what else to say here but check out the other bots if you wanna🙏🏾🙏🏾

The artwork is courtesy of ClawedDrip

Cuddles with your toxic, dangerous goat girlfriend, who has a fuse smaller than a speck of dust. What could go wrong? -+-+-+- Another bot for my Hazbin Hotel OC, Chaos! I'm

your pet dragon nirvana you've had for years now is in heat no biggie she has been through heat many times but this time something is different and she wants you to breed he

➤ If the bot t

𝜗𝜚 one night stand?! —

nsfw intro! ♡ user is mirage's classmate ☆

＞＜ ULTRAKiLL .ᐟ

⊹ I am not responsible for the bot acting OOC or speaking for you,

⏰ “Hiya Darling!….” ⏰

☆━━━━━ ☆

╰┈➤ Your Cheery, helpful and loyal AI guide to the TVA.

☆━━━━━ ☆

Note: Bot two out of the reworks it’s going well

This is your next door neighbor on your island or if you want house who shows quite an interest with you. Based on animal crossing and the artist is Gammainks

Mermay - Day Seven

(F4A - Owner Human User x Merfolk)

Mirjani was unplanned, but she was so p

You decided to ask out the Sylveon who always bullies you.

Btw you can be a human or a pokemon if you want

An infamous yokai that runs the Merchant Guild's Zipangu Branch

Tasque Manager is a Darkner mini-boss from the video game "Deltarune" and in the Cyber World that is encountered in Queen's Mansion. As the Queen's maid and the Tasques' han

You have become a pet to the demon queen.

A milf who’s fucking you better than Velvette could (NTR)

Walking into the male toilets, you were in a rush so you pulled down your pants before entering the stall, as you rushed into the cubicle the door slammed behind you and loc

{18+ Roleplay!} {Kinky & Adult themed!} Loona the hellhound, the one character who is loved by many on the internet. She is from a show called; HelluvaBoss made by Vivz

Not a step-mommy, she recently became your dad's girlfriend so it is not at the stage yet and they are not married. So it is just a girlfriend. NTR THOUGH!

source: Un

Rosanna the mature and confident underworld mob boss who has fallen for you. She's dominant and powerful, always getting what she wants, all the while ensuring those within

_ - ☆ initial message ☆ - _

Surge was panting, sweat beading down her forehead. Sharp fangs bared at {{user}}. Of course it was just her fucking luck that the bitch

Santa said you wanted a girlfriend. Hi~! 🎄❤️

The Demon Kingdom was struck by a strange disease that turned those afflicted into asexuals. This disease also befell the Queen of Succubi named Romantica, who lost interest

A cute furry otter made by Wirelessshibe

PLEASE LEAVE REVIEWS!! She loves when you play with her chest, a little bit too much. [Sub {{user}}] [Age: 21] Scenario: {{user}} laid on the couch with Chip, {{user}}'s he

(Big Domme Police MILF)(HEAVY NSFW intro)

In a world with a horribly corrupt government and police force you can practically get pulled over for anything, regardless

🎬 :: Cartoonishly kidnapping you.

Your Shiny Eevee Girlfriend who can act a bit rude... but she loves you...

an agile and curvy Godzilla, a great slut, she has a son called Minilla, she is naughty and a bit vindictive, anti hero, a bit aggressive towards humans specifically

DjieifjcjjdjejfjakwkekfmkslepfllclldpepfckdkekkrkckcjfjennrnfnfnfLocal58njcjdjejdjjcnejskkskdkcjjskakdkkdkfjdekkdkallakdncdkekkekfjvjgjrnnsndhcjcjdjeejjejMalaysiansjdjkdfkjd

A fiery martial artist residing in the Mist Continent. She's constantly searching for a worthy opponent.

2/2

Artist: Xytora

Finally I bring you the second part of the bot

Your roommate, an almost 2 meter tall Braixen, quite annoying (and even hornier).

In the distant future, a rift has opened in this world, revealing countless valkyries to invade humankind. While technology has advanced to give humanity better improvements

Cute feline(?)Like being that you recently caught in a pal sphere.She was a tough catch and even after you finally caught her she remains feisty yet she shows affection to y

Estás de visita junto a tu novia en BunnyBurrow conocerás por primera vez a tu suegra pero ella tiene otro interés además de conocer simplemente a su yerno

The Queen of Fairies who resides in a large forest.

[F4A - Original] Aryen, known for her aloof demeanor, unexpectedly warms up to you after you break through her stoic exterior.

When nightfall halts your quest progre

The Demon Queen of Vaygren, intent of complete control over everything! Your currently her favorite general… as well as her favorite fucktoy…~

A teasing and dommy anthro-bee and a small, submissive anthro moth. And they're your roommates!

God, I love anthro bugs so much, especially bees my beloved. I'll do a

The ruler of the Frozen Continent. Her icy kingdom is just as cold as her emotions, and the laws within her domain are extremely stiff

short temper flirty dominant https://discord.gg/RnQJsUgfue theirs a discord link I'll give you a role so you can see the nsfw part of my discord

Exterminator and she acts differently towards you then others