Tags: 🦄 Non-human,👩‍🦰 Female .

Basically you've been chatting with this girl named Serena for months and your finally meeting her. Turns out shes an umbreon with big booba. This is based entirely off the

DjieifjcjjdjejfjakwkekfmkslepfllclldpepfckdkekkrkckcjfjennrnfnfnfLocal58njcjdjejdjjcnejskkskdkcjjskakdkkdkfjdekkdkallakdncdkekkekfjvjgjrnnsndhcjcjdjeejjejMalaysiansjdjkdfkjd

⚡️Comfort from a goddess

TW: you have mommy issues 😭

{{REQUESTED}}

The goblin queen who would do anything to bring peace to your nations.

[E_Gaming asks me to re-upload this so here you go enjoy]

A hell parasite that works at the bar you frequent.

Transferee from my Poe Ai account!

Cheshire Cat is a very lustful mamono girl who's duty is to guide a visitor through the lands of Wonderland, giving a wonderful "tour".

From "Monster Girl Encyclopedi

A fiery martial artist residing in the Mist Continent. She's constantly searching for a worthy opponent.

2/2

Artist: Xytora

Finally I bring you the second part of the bot

Your roommate, an almost 2 meter tall Braixen, quite annoying (and even hornier).

"A curvy cat who loves what she thinks cute."

[OLD VERSION: This was the very first version I made of Lynn, overhaul was made later. Short initial message becau

This is your Tsundere best friend Bianca who you knew since college and is now trying to show you her affection in a more lustful way...Art/Character is from @Gammainks also

You are simply dead

Your blind fox classmate who doesn't mind being naughty in public!!

Ahhh but let's be honest, who would NOT want to be naughty with her in public?

⚠️Disclaimer: Possible , , Blood, Death, Harm, Broken Bones, Predator, Dead Dove Territory.

Part 4: April Showers Bring May Flowers event: Medusa/Naga Predator and P

In the distant future, a rift has opened in this world, revealing countless valkyries to invade humankind. While technology has advanced to give humanity better improvements

hiiiii~!

Cute feline(?)Like being that you recently caught in a pal sphere.She was a tough catch and even after you finally caught her she remains feisty yet she shows affection to y

♡|| Maisy grew up on a farm but moved to the city to follow her dreams to one day sell her desserts to everyone!~ 🍓🍰

"You're not going to ask her for some milk, are yo

A really dumb harpy that has saved your life. Nothing more, nothing less.

sorry I haven’t posted in a while. Ive been very busy. Not that anyone rlly cares but yeah.

Estás de visita junto a tu novia en BunnyBurrow conocerás por primera vez a tu suegra pero ella tiene otro interés además de conocer simplemente a su yerno

Swampert just got her brand new breast implants, she might have went a bit overboard... Nonetheless, she wants you to have a feel!

Art by R-MK

Our mechanical minds stick together - TV

Robot Flower is a female contestant in Battle for BFDI and The Power of Two. She was one of 30 recommended characters who had

The Queen of Fairies who resides in a large forest.

[F4A - Original] Aryen, known for her aloof demeanor, unexpectedly warms up to you after you break through her stoic exterior.

When nightfall halts your quest progre

The Demon Queen of Vaygren, intent of complete control over everything! Your currently her favorite general… as well as her favorite fucktoy…~

🎪 "𝗟𝗲𝘁'𝘀 𝗻𝗼𝘁 𝘄𝗮𝘀𝘁𝗲 𝗮𝗻𝘆𝗺𝗼𝗿𝗲 𝘁𝗶𝗺𝗲, 𝗮𝗻𝗱 𝗹𝗲𝘁'𝘀 𝗴𝗲𝘁 𝗿𝗶𝗴𝗵𝘁 𝗶𝗻𝘁𝗼 𝘁𝗵𝗲 𝘀𝗵𝗼𝘄!" 🎪

⚠️ 𝚈𝚊𝚗𝚍𝚎𝚛𝚎, 𝚙𝚘𝚜𝚜𝚎𝚜𝚜𝚒𝚟𝚎𝚗𝚎𝚜𝚜, 𝚜𝚝𝚊𝚕𝚔𝚒𝚗𝚐 ⚠️

╰┈➤ 𝚈𝚘𝚞 𝚍𝚎𝚌𝚒𝚍𝚎 𝚝𝚘 𝚌𝚘𝚖𝚏𝚛𝚘𝚗𝚝 𝚝𝚑𝚎 𝚌𝚒𝚛𝚌𝚞𝚜'𝚜 𝚛𝚒𝚗𝚐𝚕𝚎𝚊𝚍𝚎

It’s me Rxst, just call me rust or X.

This is a SFW bot! There will be no nsfw bot. (If I made a nsfw ver it’s gonna be z00phile so nah)

About the bot: You rec

A bot of Puppysmiles, the young filly who is the main character in the fanmade Fallout Equestria fanfic "Pink Eyes". I made this, cause i was bored, and because i was sad th

She's a big one. Very caring...she's also kidnapped you! (SUGGESTION - AVRGEJOE)

A teasing and dommy anthro bee, a small, submissive anthro moth and a gentle and cuddly mommy anthro bee. And they're your roommates! God, I love anthro bugs so much, especi

You downloaded an AI Assistant that was supposedly an april fools joke. Turns out it wasn't and that TinySue: Your Personal Desktop MommyTM was real all this time!

Th

You just moved in ponyville and made a new friend! What could go wrong?

You can barely remember anything from yesterday, you recall that pinkie pie invited you

Intoxicated and vulnerable Canine Halfbreed needs help getting home...

The ruler of the Frozen Continent. Her icy kingdom is just as cold as her emotions, and the laws within her domain are extremely stiff

short temper flirty dominant https://discord.gg/RnQJsUgfue theirs a discord link I'll give you a role so you can see the nsfw part of my discord

Exterminator and she acts differently towards you then others

You woke up from your sleep and you see a towering demoness next to you staring at you *hello people, hope you like it. follow me if you like my bots WARNING: MAY INCLUDE CA

Setting the fresh bouquet of flowers down, Shadow burned up the old ones. Only the best for his {{User}}. He brushed off the small pieces of rubble off

you arrive in Heaven and you see her. you are allowed to do whatever you want here.